PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C018820P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 490aa    MW: 53127.2 Da    PI: 6.3807
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C018820P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.5e-174087148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +l+d+vk++G g+W+++ ++ g+ R++k+c++rw ++l
   MELO3C018820P1 40 KGPWTSAEDGILIDYVKKHGEGNWNAVQKHTGLARCGKSCRLRWANHL 87
                     79******************************************9986 PP

2Myb_DNA-binding49.97.3e-1693136146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE+ ++++++++lG++ W++ a+ ++ gRt++++k++w++
   MELO3C018820P1  93 KGSFSQEEERIIIELHAKLGNK-WARMAAQLP-GRTDNEIKNYWNT 136
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.2583587IPR017930Myb domain
SuperFamilySSF466891.72E-2938134IPR009057Homeodomain-like
SMARTSM007171.0E-123989IPR001005SANT/Myb domain
PfamPF002494.0E-154087IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-234194IPR009057Homeodomain-like
CDDcd001675.18E-114287No hitNo description
PROSITE profilePS5129425.98388142IPR017930Myb domain
SMARTSM007175.5E-1692140IPR001005SANT/Myb domain
PfamPF002499.3E-1593136IPR001005SANT/Myb domain
CDDcd001671.55E-1195136No hitNo description
Gene3DG3DSA:1.10.10.602.9E-2595141IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MVESKGEKGK SEGDHQNHGG GGGGGGGGGG GEKGGRALKK GPWTSAEDGI LIDYVKKHGE  60
GNWNAVQKHT GLARCGKSCR LRWANHLRPN LKKGSFSQEE ERIIIELHAK LGNKWARMAA  120
QLPGRTDNEI KNYWNTRMKR RQRAGLPLYP LEIQQEATAF HLRNHHHHHH HNSTSAAGVA  180
TNFSVIRHKP DFSNQNSVSI FNFSSTMNNY QKNFNDGSSF FSTPTSQFKF FPDNNNGGGF  240
ALPLSPVSPF PQIGQQMNQS FSSPPQAAFQ LSYGNYVCNS NSELPSIQTP PHSNTPASSG  300
TSGGEGIMAA ANSGLLDVVL LEAEARSRNE KQSKEESSSA GEMKQRMDQG STEEEDANLY  360
VESVLGSSVG EAATAAEHHS DEFSSSHSSS RKRPRMEPLE EMDSMDDDDL MSLLNNFQSG  420
MPVPEWYPGS SDDDLTMNMQ NGPSLCESNG NPGGDEQQQN VASPSAVASS PVLEWSLGSS  480
CWNNMPSIR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-33381415107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00287DAPTransfer from AT2G32460Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6817920.0LN681792.1 Cucumis melo genomic scaffold, anchoredscaffold00034.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008455547.10.0PREDICTED: transcription factor MYB86
TrEMBLA0A0A0K6U60.0A0A0A0K6U6_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF99493240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.11e-73myb domain protein 33